PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011098639.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 510aa    MW: 55383.3 Da    PI: 5.6799
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011098639.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-39144203261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++k+l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  XP_011098639.1 144 PDKILPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNS 203
                     7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-31131201IPR003851Zinc finger, Dof-type
PfamPF027018.4E-32146202IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.882148202IPR003851Zinc finger, Dof-type
PROSITE patternPS013610150186IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MSEVKDPKLK LFGKTIELPD TFAAAAESGG PVSAQTFEGA GEDSLNQDPP CSSNSMLEDS  60
SFNRDGEDQE SFKSLSGPTQ EHEKEEDRAQ PLTLEELKDS NANPPIVEDS NAPADSDAGS  120
MKMSKNEEDQ AETSNSQEKS LKKPDKILPC PRCNSMDTKF CYFNNYNVNQ PRHFCKNCQR  180
YWTAGGTMRN VPVGAGRRKN KNSISQFRHL TVPEALQTPR VDLPNGIHHP ALNPNGTVLT  240
FSSDSRLCES MASVLNIVDK TIMNNSRNGF HKPDELGIPA SRGSKEAGDD CTSRSSTAAT  300
SSKDNGKTGL PELMPNCRPF PPQVPCFSGA PWPYPWNSVQ WSSPVSPPTF GPASFPVPFY  360
STATPYWGCA VPGAWNVPWV IPPTPSASQS HTPPSSGPNS PTLGKHSRDD NILKMADTKD  420
EETRKESNSE KCLWVPKTLR IDDPGEAAKS SIWATLGIKN DRTDSGGGGI FKAFQTQSKG  480
DEKTHVSETS TVLQANPAAL SRSLSFHESS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098639.10.0PREDICTED: cyclic dof factor 2-like
TrEMBLA0A068U1T10.0A0A068U1T1_COFCA; Uncharacterized protein
STRINGVIT_14s0108g00980.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-111cycling DOF factor 2